SKU: 69750297576

Human VAV1 (SH3-2) Protein

Sale price$189.00 Regular price$210.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 11 - Jul 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human VAV1 (SH3-2) ProteinProduct Specification Species Human Synonyms Proto oncogene vav, VAV Accession P15498 Amino Acid Sequence Protein sequence (P15498, Lys782 Cys845) KYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC Expression System E. coli Molecular Weight Predicted MW: 7. 6 kDa Observed MW: 10 kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag No Tag Physical Appearance Lyophilized powder Storage Buffer Lyophilized from a 0. 2

Product Specification


Species Human
Synonyms Proto-oncogene vav, VAV
Accession P15498
Amino Acid Sequence

Protein sequence (P15498, Lys782-Cys845) KYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC

Expression System E.coli
Molecular Weight Predicted MW: 7.6 kDa Observed MW: 10 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag No Tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

VAV1 is a crucial signaling protein that belongs to the VAV family of guanine nucleotide exchange factors (GEFs). It plays a pivotal role in hematopoietic cells, where it regulates cytoskeletal dynamics, cell migration, and immune responses by activating Rho-family GTPases such as Rac1 and Cdc42. The protein contains multiple functional domains, including a Dbl homology (DH) domain for GEF activity, a pleckstrin homology (PH) domain, and two Src homology 3 (SH3) domains, with the second SH3 domain (SH3-2) mediating protein-protein interactions. VAV1 is primarily expressed in T cells, B cells, and natural killer (NK) cells, where it participates in T-cell receptor (TCR) and B-cell receptor (BCR) signaling pathways. Dysregulation of VAV1 has been linked to autoimmune diseases and hematological malignancies.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 69750297576

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 556 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kimberly Robertson
Natrona Heights, US
★★★★★ 5
Amazon eGift Card Makes a Great Gift and So Easy to Give
Denomination: 0, Design Name: You're the best. (Animated)
I was so thankful that I could get this gift card on the Amazon website because I just had back surgery and I couldn't get out to the store to get my daughter something for helping me for a week. I just really wanted to show her my appreciation for everything she had done. I didn't know that you could do this and then I Googled it and it said I could. It was so effortlessly and so easy to do. I definitely will be doing this in the future now that I know how well it went.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
B
Verified Purchase
BG
San Leandro, US
★★★★★ 5
Always so good for those oops I forgot a special day, quick and easy!!
Denomination: 0, Design Name: Papercut Hearts (Animated)
The ecard works so will with last minute ideas. Just seems USPS and cost for mailing is of the past.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 22, 2026
A
Verified Purchase
Amazon Customer
New York, US
★★★★★ 5
Safe & Easy
Denomination: 0, Design Name: Award Winning (Animated)
Definity easy and perfect when you have no idea for a giving a gift $$$ WORKS
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
S
Verified Purchase
Santiago Arenas Novoa
Alexandria, US
★★★★★ 5
Perfect Gift
Denomination: 0, Design Name: Award Winning (Animated)
Easy to pay for, easy to give.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 16, 2026
C
Verified Purchase
Carol A. Rizzi
Whiting, US
★★★★★ 5
Great gift card
Denomination: 0, Design Name: Award Winning (Animated)
Very easy to use and send to anyone.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026

recommand products